Recrutez des pros de la création de contenu

Hi my asfhk jafhh jsgjbdezj sgsgvkssjj hdfjknyetcetesvbktfsvj dfvkzdyafjzfdajskfkkskskdkfkfkskkxkckvkhltlfkckckckckckkgkfkfkckvkfkskskkckclclclvlglflkrtltrooftiruueieiroxoflfmfnrnfnxksloasölxlcmcnfkrkrkfkxkfkfkdkwosölylflvmfmflwlsldlrlflflhlvlvlclfldlwösöföcörlrldlclhltlrlflclvlsöaövgnendkflririfkgkgksjsjdjgkxkskskclckfkleowelrlfkdllsxllcldldlflvmvmcmcmfmgmtltlrlfoco dlekglcl lflel l lyleltlhlvl l leöxlvlvlrlflflcl l lclflrlrötlhldöqöqösmgmfn mdlelflslalclcl kdlwlrlglclslslxlflcl l lflelelqlwlglclvl. Laldlglgldldlclclvl ml xleleldlflv

I’ve always loved photography and would love to collab with someone who I can grow with, I also can manage social media, business accounts, and business contracts. Growing up all i’ve wanted to do is work I missed afterschool sports, events, just for a check i’ve always been a hard worker and when life fails me or my pockets fail me I always find a way out because that’s just who I am as a person and will always have that specific character. I’m hoping whenever I can work with I can excel to growing both of our futures!

I am video editor and thumbnail designer who played minecraft and bunch of games most of my life and i believe i can edit your videos or design your tumbnails good. Im playing minecraft for 8 years and i managed +10 game channel to mention from my life im living in turkey and I am studying in the software engineering my english is good enough and i can help you to edit your minecraft or game videos up to 10 minute long. so this is my bio i hope we will get along well.

With 3+ years of experience in professional video editing, I help brands, creators, and businesses turn raw footage into polished, engaging content that connects with audiences. From corporate promos, social media ads, documentaries, and product showcases to reels, event recaps, and cinematic storytelling — I deliver edits that are clean, impactful, and tailored to your vision. 💼 Industries Served: Real Estate, Fashion, Education, Tech, Fitness, Lifestyle, Events, and more 🛠️ Tools I Use: Adobe Premiere Pro, After Effects, Motion Graphics, Color Grading, Sound Design ⚡ Fast Turnaround | Collaborative Workflow | Consistent Quality Let’s create videos that don’t just look good — they work.

What sets me apart as a creative professional is my ability to blend scientific precision with engaging storytelling. With a background in content writing and active experience in science communication, I’ve developed the rare skill of transforming complex ideas into content that’s clear, captivating, and relatable. I didn’t just learn to write I learned to write with impact, especially for diverse audiences on platforms like YouTube where attention is earned in seconds. What excites me most is the creative challenge of turning information into experience. Whether it’s scripting educational explainers, science documentaries, or infotainment reels, I bring a unique mix of analytical thinking and emotional tone that connects with viewers. I can help where others can’t especially when the topic is technical or nuanced and I always aim to make every line count. If you’re looking for someone who can write not just to inform but to inspire and engage, I bring both the skills and passion to do just that.

I've helped my clients to garner millions of views on YouTube, TikTok and Instagram, and create content they're truly proud of. In the past few years I've worked closely with Benji Krol (4M), Oli White (2M) and many more. My career has lead me both in the editing booth and behind the camera on everything from heartstring pulling docu-vlogs to educational videos and crazy challenges. I love working on videos that I am passionate about with cool creators. I have been working on videos full-time for the past 6 years and my passion for editing started at age 9 on my dad's laptop.

I’m a digital marketing specialist with a strong focus on YouTube content strategy, channel management, and audience engagement. My passion lies in helping small businesses and mission-driven brands grow their presence through clear messaging, smart SEO, and tailored content strategies. What sets me apart is my ability to turn scattered, underperforming YouTube channels into organized, high-performing hubs of engagement. I’ve worked with clients across industries—law firms, wellness brands, art studios—optimizing their videos, designing thumbnails that stop the scroll, and building playlists that guide viewers seamlessly through their content. One example I’m proud of: I helped a family law firm grow its YouTube views by 60%, boosted their impressions by over 40%, and doubled their engagement by aligning content with the audience’s search intent. I’m not just a behind-the-scenes creator—I’m a strategist who sees the bigger picture. Whether it’s analyzing traffic sources to inform content direction or using tools like TubeBuddy, Metricool, and Analytics to shape a winning strategy, I thrive on bringing order and momentum to YouTube channels that need a stronger foundation. If you’re looking for a creative partner who combines technical skills with a human-centered approach, I’m here to help you grow.

I'm a video editor who gained his skills working with a national nonprofit publication. My work has included several journalistic YouTube shorts along with multiple longer videos promoting the organization's work to funders. Having worked in the nonprofit sector with an organization of limited means, I consider myself an expert in working with limited available footage and taking advantage of public domain and stock resources to improve on footage sent.

I have spent the last year video editing for short films and youtube. I find extreme joy from being able to do this as i see the effort i put into my work and i get a finished product that everyone seems to enjoy. I believe that i differ from alotof other people due to my fast response time. I am relatively quick at editing and can produce content fast. I feel aswell where i can differ and add a unique skill set, is that i am still at college, however out college is always getting scouted or trained by high end film producers or radio shows etc. This could mean i can learn more on the fly and bring that knowledge back to help me with my video editing.

Hey! I’m Austin - A creative producer, video strategist, and YouTube nerd with a background in building content that actually performs. For the past two years, I’ve led content strategy for CEO and Founder John Hu - scaling his YouTube channel from 0 to 160,000+ subscribers and generating over 7 million views through high-impact, long-form videos. Whether it’s a cinematic vlog or an educational deep-dive, I love turning ideas into scroll-stopping stories that drive results. Right now, I’m taking on freelance projects with brands, founders, and creators who want to level up their content. If that’s you — let’s talk!